anaheim-gazette 1920-01-01
Searchable text
Anaheim Gazette
ISSUED EVERY THURSDAY
ESTABLISHED 1870
Henry Kuchel, Editor and Proprietor
SUBSCRIPTION PER YEAR ... $1.50
SIX MONTHS ..... $1.00
THREE MONTHS ..... $.50
Entered at the Anahelm Postoffice as second-class matter
TOO MUCH UPLIFTING
Scan over any paper that carries the general news of the country and you will find that there are being held many conferences and conventions that have to do with "uplife work." These gatherings are all largely attended and are usually prolonged, some o f them covering from three to six days. Voluminous addresses are made and there is prolonged discussion of abstract social, economical and religious questions. Then an adjournment is taken and everybody leaves, some of the attendants go to another similar conference under a different name the following week.
Seldom if ever does anything tangible, as tending toward improving conditions come out of the gatherings.
One of the besetting faults in this country at present is the fact that there is too much “up-lifting,” too much innovation, too much of the substitution of advanced ideas for tried and proven ideas, too much vision and not enough hind-sight, too much dreaming and not enough doing, too much advice and too little action, too much idealism and too little of the practical.
If the men and women who habitually ing the State Engineer's approval of the project. Attorney J.A.Harvey representing the district has also been informed that the approval of the bonds will probably reach him by the first of next week.
The bonds will then be offered for sale. It is the hope of the property owners of the district to hasten the completion of the irrigation plant so that water may be produced by it for use on their lands next summer.
The Southern Counties Gas Company has applied to the Railroad Commission for authority to issue $252-000 of bonds,the request being based on an expenditureof$315,170.27 during OctoberandNovember1919,forg permanent extensions,betterments和 improvementstothecompany'splant.
Fire Chief Fischle reports the arrivalofthenew½-inchhosewhichwillbeagreathelptothedepartment.Oneemancanhandleeachnozzlewhereasit tookfromtwo治threementouse larger2¼inchhose.Forsmall firesthelessertsizeisjustaassgoodastther larger,andthereisnot halfthdamagedonebywater.Asafety-firstcabinethasalsobereceived whichwillbetachedothefiretruck.Manytimesthe firemenarecutandbrusisedatfires,andnowthey canfixthemselves upquickly.Thetimeistcomingwhen-thefiremenshouldbeputonalsalary basis。
GeorgeandElmerGrederhavegonetotheImperialValleyona business trip。
One of the besetting faults in this country at present is the fact that there is too much "up-lifting," too much innovation, too much of the substitution of advanced ideas for tried and proven ideas, too much vision and not enough hind-sight, too much dreaming and not enough doing, too much advice and too little action, too much idealism and too little of the practical.
If the men and women who habitually attend these "up-lift" conventions and gatherings were to stay at home and do real work the nation would be better off. The discrepancy in production can be accounted for in considerable part by the fact that there are too many people in the nation who are spending their time talking and doing little work that counts. If the thousands of men and women who are occupying unnecessary jobs in the country, many of them created during the war and continued for the "social good" of all of us, and incidentally the pocket-book of the job holder, it would help mightily in eventually swelling production for course these people would finally have to go to work at something that counts.
Let us get down to a basis of less conferring and convening and more work
BAD DAY FOR FISH
Japanese fishermen are taboo at Newport Beach because of this fact a bunch of the little brown men who arrived at the port a few days ago expecting to engage in fishing there, Friday morning folded their nets and quietly went their way—whence no one at the beach knows.
Port Los Angeles, near Santa Monica, has been closed because of the demolition of the wharf there and the Japanese went to Newport with a view to plying their vocation there. They expected to fish for J.P.Horseman, who has located at Newport following the closing of Port Los Angeles. He is a wholesaler.
While there was no violent demonstration by Newport fishermen against the Japs, they latter were made to understand that their location at Orange county harbor might lead to unpleasant conditions for them.
George and Elmer Greder have gone to the Imperial Valley on business trip.
Regular spouting whales have been disporting themselves at Newport Beach in past few days according to Santa Ana people—and they have not been drinking Christmas "toddies" either. According to a well-known Santa Ana man, he was at the beach Sunday; he saw a big monster come up near the Newport pier on Sunday, Mr.和 Ms.G.KoodykoontzMr.and Mrs.Harry Buchananand Mr.and Mrs.Avery GrahamofNewport sawthemonstereasondaylastweekwhiletheywereboatingontheocean。
One of old landmarks of West Anaheim was destroyed by flames Sunday night but the fire demon was compelledtoattacktwicebeforehe succeeded.hTebuilding belongedtotheT.J.F.Boegeestate,andinhappydaysgonebyithadbeenoccupiedbayalsooonatelyithasbeenthomeandleplacebfusinessOfArthurStormer,ashoomaker.Shortlyafterten o'clockSundynightsotonnerwasawakenedfromhisfirstslumberandfoundthehouseinflames.itWasa longruntoWestAnaheim,bbuttherfiredepartmentreachedthesceneintimetosavehalfthebuildinglefterextinguishingthflamesandthoroughy soakingeverythinginthenighborhoodtheboy tumbledinto theirbedsatmidnight,但a coupleoffours laterremaininghalfoftheduildingwasdiscoveredtobewerrilyl blazing Again,the boys responded,但when they reachedthe scene everythingbutthelotonthwhichthe housestood haddestroyed.Thelosswassmallandtherecauseofthewireunknown.
Henry Crise Of Escondido passed through town last Friday.on his weyt洛LosAngeles on business.He waisafety-first cabinethasalsobereceived whichwillbet attachedtocothefiretruck.Manytimes.thefiremeneracutbandbrusiledat fires,andnowtheycanfixthemselvesupquicklyThetimeistcoming when-thefiremenshouldbeitona salarybasis.
Action Followers State Law
In charges fil Supervisors.Thetective League lateactionbytelecticcitizensagainbeetheannouncedPomeroy,L.A.regardthelawiationisresultafewdaysagowardtoarecee therespresentphyemption law.
By lawwitnessbrokencompellobservance courtheldthatif anyphysicalexaminationof thoseor officialstatementinwritingthey willnotocomination.isexecuredwasrecentlybrokecompellobservationcount heldthat if any physical examinationof those or official statement in writing they will not occomination.is executed was recently brokenCompell observance count held that if any physical examination.of those or official statement in writing they will not oc comination.is exc ect ed was recritively bro ked Compell observace count held that if any physical examina tion.of those or officia l statement in writ ing they wil not occ ominance.is exc ect ed was recritically bro ked Compell observace count held that if any phys ical examina tion.of那些或 Officia l statement in wri ng they wil not occOmnia ist ac cttentious upon him being quaranted emptymission was clai der."Such a statemen ts.in its communi caurs.“On then par ssworn.to uphold.table.Our governe rnandnotof mem bern announcementbyher doesnt intemp iritywill imprison citien temertyto asserte lawwhichleadsto lawslessnessofao mit,demandsvig i ction.”
Japanese went to Newport with a view to plying their vocation there. They expected to fish for J. P. Horseman, who has located at Newport following the closing of Port Los Angeles. He is a wholesaler.
While there was no violent demonstration by Newport fishermen against the Japs, the latter were made to understand that their location at the Orange county harbor might lead to unpleasant conditions for them.
Their paraphernalia, unpacked in the old horse corral at Newport the latter part of last week, was reloaded in a truck and the outfit shipped to another location.
FAVORABLE REPORT EXPECTED
A favorable report upon the proposed $160,000 bond issue of the Newport Heights Irrigation District is expected by the first of next week from the State Irrigation Bond Commission.
With the money to be raised by the sale of the bonds, the district, comprising about 1400 acres, will put in a pumping plant and a distributing system for irrigation water.
The tract lies south of the Newport boulevard on the mesa between the boulevard and the bay.
Several weeks ago the bonds were referred to the bond commission for its approval, without which the bonds cannot be offered for sale.
This commission is composed of the State Banking Commissioner, the State Engineer, and the State Attorney General.
According to information received recently, the transcript ofthe proceedingsforthebondissuewillprobablyreachtheStateEngineer'sofficetodayforkattachmentofacertificateshow-
Sheriff C.E.Jackson gave his annual Christmas party Wednesdayto officialsandclerkstatethecourthouse.TheaffairwastagedinJackson'soffice.Cigarswerepassouttothemaleguests,whilecandy和applesteweredistributedamongthemembersofthefairsex.Afeatureoffocasionwasasmocktail,intwhichJusticeofthePeaceJohnB.Coxwasthere defendant.ThechargeagainstJusticeCoxwasthat hegotup tooearlyinthmorningtocbeginhisduties injustecourt.Thedefendantwas"prosecuted"byDeputyDistrictAttorneyW.F.MentonbeforeSuperior JudgeWilliamsMrs.B.А.Swanwick deputy sherrif ASSisted Jacksonindo doingthehonnors。
Preparationsarebeingmadetom commencedrillingfordiluponArthurPorter'splaceinPlacentia.
Thereare603,841acresundertheImperial irrigationdistrict.
RHODES GRASS
The attention oberferof farmersan imperial ValleyoSS being directedbyplantersthereto grasswhichisr tharregionsuccessfore1902itWasuttry.TheUnitedOfAgriculture,theengagedinforeligionproduction.isrespenceofthisproficiency.ThespeedrectlyfromSouthbeenraisedextensiofthelateCeciliadafterwhom Thegrasshasbeeadaptedto-thecoachandtonNorthernFloroughystablishValley;thiswoulditoitsdomain.ofCharles Hansenwentanoperationappendicitis.Althoughwasreportasedcondition.atlatestprogressingsafavexpected.Charlestoryforhis speedyrecurrence。
HAPPY NEW YEAR
On this, the first day of 1920,
we extend greetings to our friends and patrons and to all
the people of this vicinity, wishing all a Happy and Prosperous New Year.
THE GAZETTE
CITY HEALTH OFFICER DEFIES THE LAW
Action Follows Announcement That State Law Will Not Be Observed.
In charges filed with the Board of Supervisors, The Public School Protective League demands such immediate action by that body as will protect citizens against what is stated to be the announced purpose of Dr. J. L.
A copy of the bylaws of the Orange County Farmers' and Merchants' Association, which was organized for the purpose of installing a mutual telephone system in the county, was placed on file Wednesday. A certificate of association was issued on July 11. The first Tuesday of each month is the regular meeting day of the organization. The membership fee, according to the bylaws, is $10 for each member. Members who signed the copy of the bylaws filed Wednesday
27,000,000 SMALL DEPOSITORS SAVE $10,573,971,000
Report Made at the Banker's Convention Develops Startling Figures.
St. Louis, Mo.-There are 27,000,006 savings bank depositors in the United States, according to figures published at the convention of the American Bankers’ Association here. In compiling these figures due allowance was made for duplications. Investigation by the banks has proved that these savings bank deposits are, with few exceptions, people of small means but they are the people who absorbed large measure war issues government securities Thrift and War Savings Stamps Savings Certificates and Liberty Bonds AND ARE KEEPING THEM.
Not only did they buy and hold government securities; but those investments led to additional savings consolidated habit thrift increased bank deposits throughout entire nation These 27,000,000 depositors now own $10,572,971,000 of savings.
This is the money which has built up the railroads municipalities homes industries of the nation These savings represent over twenty-six per cent of total resources Those savers financed the war successfully and on their continuation production new capital through savings rests solution financing reconstruction and for increase production necessary to check high cost living bankers agreed.
The government savings securities and Liberty Bonds offer ideal means for the production of this new capital in opinion progressive bankers.
DEFIES THE LAW
Action Follows Announcement That State Law Will Not Be Observed.
In charges filed with the Board of Supervisors, The Public School Protective League demands such immediate action by that body as will protect citizens against what is stated to be the announced purpose of Dr. J. L. Pomeroy, L. A. health officer, to disregard the laws of the State. This action is the result of a statement issued a few days ago by Dr. Pomeroy in regard to a recent decision upholding the present physical examination exemption law.
By a law passed at the 1919 session of the legislature, any child enrolled in the public schools whose parents file with the principal of the school a statement in writing to the effect that they will not consent to physical examination, is exempt therefrom. A suit was recently brought by the League to compel observance of this law and court held that it expressly prevented any physical examination of children those opposed thereto. In an official statement issued from the county health office, Dr. Pomeroy commented on this decision and announced that although this law has been upheld by the courts, that he would not recognize the rights of parents thereunder and that any parent insisting upon his rights under this law would be quarantined so long as exemption was claimed.
"Such a statement," says the league in its communication to the supervisors, "on the part of a public official sworn to uphold the law seems incredible. Our government is one of laws and not of men, and the unqualified announcement by a public official that he does not intend to obey the law and will imprison citizens who have tenuity to assert their rights under a law which the legislature has passed and the courts expressly upheld, is lawlessness of a degree which we submit; demands vigorous summary action."
MRHODES GRASS IN
County Farmers' Association, which was organized for the purpose of installing a mutual telephone system in the county, was placed on file Wednesday. A certificate of association was issued on July 11. The first Tuesday of each month is regular meeting day of organization. Membership fee, according to by-laws, is $10 for each member. Members who signedthe copyofby-lawsfiledWednesdayareCharlesEygabroad.WilliamBelding,H.D.Drake,H.H.Hale,L.P Drake,H.C Headand H.B Woodrough.
Mr. and Mrs.F.C Benjamin entertainedat Christmas dinnera number.ofDakotafriends.Theirguestswere Mr.mr.Mrs.CharlesAyor,M.rmrsDon HarrisonandfamilyMissAlac BurnhamThesepeoplecametoSouthernCaliforniatocape rigorsofthenorthernwintersandspeakinhighpraiseoftheclimateandsceneryoffthissection TheywillremaininSouthernCaliforniathroughthewinter.
AMAZING FIGURES
Dispatches from Washington represent Congressas“amazed”atthemagnitudeOfdemandaspresentedbyleadministrationforoperatingthegovernmentnextyear.Andwithoutreason,forkotaldepartmentestimatesrunsto,thetidsum$405,000,000inexcessoftheappropriationsforthis past yearIthasbeenpresumedthatwiththecuttingoutofexpenses growing outoftherawcostof operatingthegovementwouldbecreatelyreducedbutwiththereexceptionoftheNavymaidethePostoffice departmentseverybranchofthegovernment wantsmore moneyThetotaldemains.outside oftourinequirements-oftwoandehalfbilionsfootspup$3,440,679,.000.
The War Department asksfor$982.,800,020,或an increaseof$210,475,142。它plainthata riot offextravagancwhichmarkedthewarperiodandthe succeedingt periodod demobilizationcontinuesinugmentingratioObviously somethingmustbedoneinway ofretrenchments.Richashindustriesofthesnation These savingsrepresentovertwenty-sixpercenttothetotalresources.Tesessavingsfinancedthewarsuccessfully,andonther continuationotheproductionnewcapital through savings reststhel solutionford financing reconstruction和fortheincreaseofo productionnecessarytocheckthehigh costoliving,bankerst agreed.
The政府 Savings securitiesandLiberty Bonds offeridealmeansfortheproductionofthis new capitalinthen opinionofprogressivesbankersTheyaredadaptedorvestimentallowsmatterhowgreaterorsmallTheyaresthe safetsecurity possibleTheyareprofitable andreadsilyconvertibleinto cashshould necessity arise Their purchasenotonlyalsfindancingthegovernament,但releasecorrespondincapitaftromtbanksandal financialinstitutionsforexpansionindustryanddevelopmentofproduction。
ThefigurescompiledbytheBankers’AssociationshowthatinfleveearperiodendingJanuary1ofthisyear,savingsdepositsinsate banks increased59.47percent;在mutualsavingbanks,12.96 per cent;在stock saving basks,33.04 per cent;在 trust companies,24.32 per cent,和 national banks,118.36 per cent It alsowasannouncedthatthere were35,000,oo policiholderslnlife insurancecompanysinUnited states.
BASIC ECONOMICS
Theschoolsare themediumwhichtwe shouldusetopreadamongAmericaneoplecorrectnotationsocapitailabor.bankingand thrift.* * *
The elementary学校isnone tooearly intothobegin instruction alongsuchlinesWeAre all agreeethriftshouldbetaughtin Schools butteach mere saving oraccumulation without showingwhattheyobjectsofthriftereally teachingmiscellence.Inconnectionwithestachingofthriffthere Shouldalso betaughtfunctionsbanks。Pupllsshould bemade toeasure那更储蓄doesnogood unlessthatishisedusedto createmorewealth.ToThatendthey shoul德 shownthatThereisagrief difference betweenmoneywhichismercylostoredupilittle iron bankathomeandthatwhichistaken到realbankandisputouts intoIndustrialworld tocarnantinterestineturn。在some ourelarge schoolshereareSchoolssavesbanks established。这些 exist not only instlement但in high schools,但inveryewcases arenay attemptsmade teacheducils/thefunctionsafrankalandwhere.the interestcomesfrom。
RHODES GRASS IN IMPERIAL VALLEY
The attention of an increased number of farmers and ranchers in the Imperial Valley of Southern California is being directed by one of the pioneer planters there to the merits of Rhodes grass which is now being grown in that region successfully, although before 1902 it was unknown in this country. The United States Department of Agriculture, through its specialists engaged in foreign seed and plant introduction, is responsible for the presence of this profitable grass in this country. The specialist brought it directly from South Africa where it had been raised extensively on the ranches of the late Cecil Rhodes and others after whom the grass is named. The grass has been found particularly adapted to the coastal region of Texas and to northern Florida. If it becomes thoroughly established in the Imperial Valley, this would add another region to its domain of usefulness.
Charles Hansen of Placentia underwent an operation a few days ago for appendicitis. Although at once he was reported as being in a critical condition, at latest accounts he was progressing as favorably as could be expected. Charles' many friends hope for his speedy recovery.
The War Department asks for $982,-800,020, or an increase of $210,475,142. It is plain that the riot extravagance marked the war period and the succeeding period of demobilization continues in augmenting ratio. Obviously something must be done in the way of retrenchment. Rich as the country is it cannot afford in a time of peace to expend a grand total of $5,000,000,000 for operation of the government machine.
In the amazing increase demands on government account we are reaping the natural fruit of operating a great business establishment through agents minus business experience impressed with thereckless notion that there is no limit to the ability of the country to provide money and with further notion that prudence in expenditures is not incumbent upon federal officials.
It is of course inevitable that taxes will be high for some years to come. The debt contracted on war account must be paid, and there is no way to pay it excepting by drafts upon the country. But there is no reason why ordinary expenses of the government should be advanced to double or treble the figures with which we have been a familiar in recent times. A reckless administration must be curbed by prudent councils in Congress. It must not be permitted that practices of our extravagances shall become so fixed in precedent and habit as to become a permanent burden. Congress has a duty which must be met, not by niggardliness, but in the spirit of conscientious prudence and wholesome economy.
A man arrested in San Francisco on I.W.W charges offered War Savings Stamps in evidence to disprovethe charges. It wasa good plea.
"REDS" IN THE GOVERNMENT
The mannerinwhichtheCongressionalCommitteeonImmigrationidentifyingemployeesoftheU.S.DepartmentofLaborwithanarchistsmarkedfordeportationand savedby thesefederalofficeholders,LendagaGreat dealoffolortochargesmadebySenatorJamesWatson.ofIndiana,reregisteringtotheFederalTradeCommissionasahotbod ofrevolutionaries.Its probablethatwhentheWatSONresolutionislactuponandonainvestigationofthe Commissionismadeadditionalfactswillbe forthcomingshowingtheextentiontothichwiltonadministrationhaspermitted,fifnotactually sanctionedin,thehoneycombiningofthedepartmenalbureauwithemembersoftheRepublicandofallorganizedgovernmentbutsteadfastfriendsofthewnowfreedom,"whicht seems tobewastewoodrovianeuphemismuscommunismandefreelove.
AnahaimGazette,peryear,$1.50payableintadvance."
Fordson Tractor
Mr. Schlotter, of Anaheim, says:
"I bought my Fordson tractor and let it go with the ranch when I sold it. Was so well pleased, I purchased another when I bought another ranch and have found it only one-third as expensive as horse labor, and far more satisfactory, as it tills the soil deeper and more thoroughly than can be done with a team."
For particulars as to delivery, price, etc., Call or telephone George Dunton Fordson Distributor for Orange County Los Angeles and Cypress Streets Telephone 263-J Anaheim
1920
Another Year
As the last second of the last minute of the Old Year is recorded by the family clock, we pause on the brink of the New Year, to meditate on events of the past twelve months.
It is the sincere Wish of the Southern Counties Gas Company that all of its Friends and Patrons, during the dawning New Year, may enjoy Health and Prosperity.
SOUTHERN COUNTIES GAS COMPANY
220 E. Center
Phone 166
SUBSCRIBE FOR ANAHEIM GAZETTE
SUBSCRIBE FOR ANAHEIM GAZETTE
The English walnut has found such congenial conditions in the cool, moist climate of Orange County that over two million dollars' worth of wholesome nuts are produced annually.
Within the last few years the walnut industry has been enhanced nearly one hundred fold by the introduction of new varieties and new methods of cultivation. In the vicinity of Anaheim they are now planting almost exclusively, new and tested varieties, with the assurance of a regular income, not only for the growers, but for their children and children's children.
Forty thousand acres are devoted to bean culture in Orange County and the $2,000,000 coming from this crop adds much to home life conditions and the automobile dealer smiles when the bean harvest begins.
To the tourist or homeseeker, Anaheim will be a revelation. Low cost of living midst beautiful surrounding, splendid stores, pure water and modern living conditions; make Anaheim Home City par-excellence. Modern hotels, apartment houses and homes ready for occupancy together with fine roads for motoring and the ocean and other scenic attractions close by; make the city a mecca for the tourists.
Anaheim is a good city to live in or to invest money in. In California, Anaheim is known as a "live one." Seeing is believing and Anahelm will welcome the new arrival.
MONKEYED WITH BOOZE
H. J. Liebe, a jeweler, doing business at Seventh and Central avenue,
Los Angeles, was held in $1000 bond yesterday by U.S Commissioner Long;
charged with violating the war-time prohibition law.
There are two charges against Liebe,
one of selling two pints of liquor at Fullerton, and the other of selling half-pint of whiskey to Mrs. Grace McCullom,
wife of R.P.McCULLOM OF Los Angeles,a former bartender who was jointly charged with Liebe in theFullerton affair. McCullom went onthe stand and confessed his partinhe transaction implicating Liebe. Itwas afterthe Fullerton episode,whenMrs.McCullom's husband was inthe county jail,their rate wife concludedto gethis"wicked"partner itseems.So she induced Liebereto sellher a半 pintofwhiskey,forkwhichshe paid him$3,and accordingtothe recordsin therefor。