anaheim-gazette 1882-12-02

ANAHEIM VOL. XIII. WEEKLY GAZETTE Established 1870. For Terms, see Fourth Page. DR. JAMES ELLIS. OFFICE AND DRUG STORE IN THE BUILDING East of Anaheim office. Office hours at 7 A.M. and 9:30 A.M. and at 2 P.M. and 6 P.M. DR. E. L. COWAN, Dentist, Has opened an office in the upper part of Mrs. Metz's building, Los Angeles Street, Anaheim. Having had twenty years experience, he can speak with confidence of his work. He scale of prices is very low. He will be found in his office every day between the hours of 9 A.M. and 6 P.M. GEO. B. SHAFFER, NOTARY PUBLIC. OFFICE—BANK OF ANAHEIM. RICHARD MELROSE, NOTARY PUBLIC. GAZETTE OFFICE. IF YOU WANT TO GET RID OF SQUIRRELS AND GOPHERS USE CARBON BI-SULPHIDE Everybody who has used it recommends it as the ONLY SURE EXTERMINATOR Of this vergin. For sale by A. LANGENBERGER, Dealer in Groceries, Hardware, Paints, Oils and Crookery. City Stables, Center Street (Opposite Kroeger’s Block), ANAHEIM. L.F. Lewis. -- Proprietor. THESE STABLES ARE THE BEST VENTILATED and most commodious in the town, and special attention will be paid to Boarding and Grooming horses. The charme in all cases will be reasonable. REPORT OF ERS’ COMPILE The State Convicted in San Jose on first day was devoted forenoon, while an uselessness of all or termination of peace selected, and the ad inflection of return very interesting which were the years ago, at the there were a few possibly not more from these the whited with insectington Territory, on the south; the warm soil, proving opments. A single happe, eighty eggs erations perfect in foreseen the pern them he would ha GEO. B. SHAFFER, NOTARY PUBLIC. OFFICE—BANK OF ANAHEIM. RICHARD MELROSE, NOTARY PUBLIC. GALETTE OFFICE. H. C. KELLOGG, Surveyor and Civil Engineer. PARTIES DESIRING TO CONSULT ME PERSONALLY will find me at the residence of B. F. Kellogg. Address, Anaheim P.O. THEODORE LYNILL, Attorney-at-Law. ANAHEIM, CAL. Office in Planter's Hotel Building. MONEY TO LOAN.—Ruling rate 10 per cent. ROBT. W. SCOTT. ATTORNEY AT LAW AND NOTARY PUBLIC. Commissioner of Deeds for Arizona Territory. Kroeger's Block, Anaheim, Cal. VICTOR MONTGOMERY, Attorney-at-Law. SANTA ANA, CAL. Office in Dibbles' brick building, nearly opposite the Peat office. Office hours from 10 a.m. to 3 p.m. M. L. WICKS, Attorney-at-Law. Rooms 86 and 87 Temple Block. LOS ANGELES. MONEY TO LOAN. Apply to W. SCOTT, Attorney at Law H. J. STEVENSON, Deputy U. S. Land and Mineral Surveyor. Office: Room No 4, Downey Block, LOS ANGELES, -- CAL. L. GUNTHER, Pleneer Boot and Shoe Maker, Cor. Adele and Los Angeles streets. ANAHEIM. GEORGE BAUER City Stables, Center Street (Opposite Kroeger's Block), ANAHEIM. L.F. Lewis.-- Proprietor. THESE STABLES ARE THE BEST VENTILATED and most commodious in the town, and special attention will be paid to Boarding and Grooming horses. The charge in all cases will be reasonable. Single and Double Teams Furnished at short notice, and careful drivers, familiar with the country, supplied when required. The patronage of the public is respectfully solicited. D. E. MILES, Warehouseman and Commission Merchant. Highest Cash Price Paid for Wheat, Barley, Corn, Rye, Potatoes, And all Country Produce. Cash advances made on all consignments of Grain and Wool. Sacks and Twine At lowest market prices. Office opposite Railroad Depot, Anaheim, Cal. B. DREYFUS & CO. Growers and Dealers in California Wines and Grape Brandy. 630 to 642 Drannan Street, San Francisco; 45 Broadway New York. A. E. WHITE. E. A. WHITE BLACKSMITHING AND Wagonmaking! All Work Warranted. Prices as low as the lowest. Center Street, Anaheim. Planters' Hotel, ANAHEIM, CAL. which were the first years ago, at the S there were a few possibly not more from these the wh lated with insect ington Territory, o on the south; th warm soil, provin opments. A single hap, eighty eggs a erations perfect in foreseen the perm them he would ha into the Ark, "oula lation of damage o its progeny in a si hundred and eigh pears. The oppo in San Francisco o to prevent the pr existing quarantine use destroying per the return packet infection, as a hun one destroyed. A by being brought old ones. The job and shaking out the old ones, when th ones until new boo than the old ones to examine the boo the assertion, as t crack and corner. hopper, the pla woolly aphis and s The woolly aphis cessive multiplying tillion per year; i lives there still an chief. The safety terest depends on quarantine laws. This was follow Tuska, of San Fran "Laws relating to by calling attentio very large attenu from all parts of portance and inte At the evening San Francisco, s of local association that had both S natural Societies; m California, and that now had suic Thursday, Nov committee on nu report thought not be enforced opposition and foreign countries many especially, the return of a s to California, bee to enter there ing discussion f that he thought He thought the ed up to the po laws can be now Deputy U.S. Land and Mineral Surveyor, Office: Room No 4, Downey Block, LOS ANGELES, - CAL. L. GUNTHER. Ploneer Boot and Shoe Maker, Cor. Adele and Los Angeles streets. ANAHEIM. GEORGE BAUER, BOOT AND SHOE MAKER, Center Street Making and Repairing at the Lowest Cash price. All orders promptly attended to. All work guaranteed. CHARLES WILLE, COOPERAGE. Pipe, Barrels and kegs on hand at all times. Tanks and Tube made to order. Honey Barrels for sale cheap. F. & J. BACKS. Importers, Manufacturers and Dealers in Furniture, Bedding, Paper Hangings, Picture Frames, etc. UNDERTAKERS. Agents for the Howe, Eldredge and Victor Sewing Machines. Los Angeles Street, Anaheim. JOHN HANNA, Real Estate Agent. Live Stock Bought and Sold on Commission. ANAHEIM. ANAHEIM BAKERY. WM. MEEK, Proprietor. FIRST-CLASS STOCK OF BAKERY GOODS always on hand. Calms for parties or wedding music to order. The percentage of the public is included. AND Wagonmaking! All Work Warranted. Prices as low as the lowest. Center Street, Anaheim. Planters’ Hotel, ANAHEIM, CAL. J. E. STACKPOLE, Manager. THIS POPULAR HOTEL ESTABLISHED IN 1863, has just been thoroughly renovated throughout, and is now in such condition as to secure for guests the Very Best Accommodations. The Tatle will always be supplied with all the Delicacies to be obtained in the Market. An elegant Billiard Hall and Reading Room for amusement of Guests. The Bar supplied with only the best of Wines, Liquors & Cigars. OFFER COACH to the House from all trains. PROF. W. A. PACKARD, TEACHER OF Vocal and Instrumental Music, ANAHEIM. KIDNEY-WORT THE GREAT CURE FOR PHYSICIAM Mr. A. D. Prylhalt a million treasure land; they were fully infested North and fruited here. If a quarantine was not added from the fruit-promised tomologist, who California insect same, and to give University. The ed the drying of that would come world, and that sociation be made Mr. Britton grower and a sentent to the cannibalization that, when they should be yard of the cannibals who wanted to pose. A man witory and ask the ing told they were there was no us price as he could the canneries for Another man thought the frew would all come est was in stopping from houses were used not be piloted so that they were that goal fruit Mr. Pithin REPORT OF FRUIT GROWERS' CONVENTION. Compiled for the Gazette The State Convention of Fruit Growers met in San Jose on November 14th. The first day was devoted to organizing, in the forenoon, while an able address from Prof. Dwinelle, President of the State Board of Horticulture, and the annual report of Chief Horticultural Officer Cooke, occupied the afternoon. In the afternoon of the second day a paper, by Mr. Jessup of Alameda county, was read, the subject being, "The evils of the return packet," in which was set forth the uselessness of all other measures for the extermination of pests, while this was neglected, and the advantages of thorough disinfection of return-fruit packages. Some very interesting points were given, among which were the following: About nine years ago, at the State Fair at Sacramento, there were a few infested pears or apples, possibly not more than three or four, but from these the whole coast had been populated with insect fruit pests—from Washington Territory, on the north, to San Diego, on the south; the long, dry seasons, the warm soil, proving favorable to these developments. A single coiling moth lays, perhaps eighty eggs at a time—but several generations perfect in a year—until, had Noah foreseen the pernicious effect produced by them he would have left the pair he took because free houses, and to other dealers than the canneries, 4.00 those sold to retail dealers, are sold by them out to individuals who take them home, after using the fruit throw the box out in the yard, where they have, possibly a true or two. The insects from the box infect his one or two trees and from them spread to five hundreds owned by an adjoining neighbor. Mr. Jessup recommended using the empty fruit boxes for fuel under the engines of the commission houses and canneries, and was ready to contract to withdraw his trade from any commission house or cannery that would not contract to use all boxes sent to them. In this manner the commission houses and canneries could be quarantined. Prof. Dwinelle was sorry that Mr. Cutler, of San Francisco, was not there to speak for himself, as that gentleman had told him repeatedly that he (Mr. Cutler) would allow one half the price of the box to the shipper, as thus he would be enabled to dispense with the services of two men whom he had to keep all the time to put up return boxes, and besides that he thought the boxes were worth something for fuel. Then it costs from two to four bits to express back to the shipper boxes worth six cents. After some further discussion the report under discussion was amended so as to "new fill packages" and was adopted, as amended, by the Convention. Mr. Holt, of Riverside, recommended the holding of semi-annual Conventions in the means of the trade." First, boxes of regular sizes and uniform weight, well packed, with the top layer surfaced. Second, each kind or variety by itself, no mixing two or more kinds together. All fruits when dried should have the appearance of fresh fruit. This can be done in a simple and cheap manner, resulting in an increased demand for the product. Fruit of any kind to be dried should be placed on the tray as soon as peeled or stoned, then placed in a tight box, say from twelve to eighteen inches high, twelve inches if only one tray is used but it needs to be higher if more trays are used, and a teaspoonful of burning sulphur placed under the tray and allowed to remain there four or five minutes. (The sulphur should be put into a pan containing hot coal.) This is all that is needed to be done, then the fruit is taken out and placed in the drier or on boards if it is to be dried in the sun. The object of the process is: First, the fruit is clean, retains its original color, and has the appearance of fresh fruit. Second, it is less likely to contain worms, the odor of the sulphur driving the insects away so that they will not lay their eggs on the fruit. Third, the action of the sulphur on the fruit closes the pores, stopping the secretion and thereby adding to its weight. I have traveled thousands of miles in Oregon and Washington Territory, giving instructions how to dry their apple crops. Such large quantities are raised in Oregon that they are compelled to dry them, as there is no outlet for green fruit. California cannot supply the demand existing today, hence is compelled to seek for supplies in her neighbor State. We now ask if you will follow our instruction: Give us good clean fruit, we pay you good clean money for it, and you will find that the amount of bright dried fruit can not be overdone. We want more than you will be able to dry which were the following: About nine years ago, at the State Fair at Sacramento, there were a few infested pears or apples, possibly not more than three or four, but from these the whole coast had been populated with insect fruit pests—from Washington Territory, on the north, to San Diego, on the south; the long, dry seasons, the warm soil, proving favorable to these developments. A single coiling moth lays, perhaps eighty eggs at a time—but several generations perfect in a year—until, had Noah foreseen the pernicious effect produced by them he would have left the pair he took into the Ark, "out in the wet." The calculation of damage done by a single moth and its progeny in a single season, equaling six hundred and eighty-one boxes of apples or pears. The opposition of a certain firm in San Francisco (A. Lusk & Co.) did much to prevent the proper carrying-out of the existing quarantine laws, and there is no use destroying pests in the orchards while the return packets are shipped without disinfection, as a hundred came back for every one destroyed. New boxes are also infested by being brought in the same car with the old ones. The jolting of the car loosening and shaking out the insects lodged in the old ones, when they took refuge in the new ones until new boxes were as bad or worse than the old ones; it only being necessary to examine the boxes, to prove the truth of the assertion, as they are found in every crack and corner. The red spider, the vinehopper, the plant-louse, the phylloxera, woolly aphis and scale, are all to be dreaded. The woolly aphis produces, counting successive multiplying generations, one quintillion per year; if one in every thousand lives there still are enough to do great mischief. The safety of the fruit-growing interest depends on the carrying out of the quarantine laws. This was followed by a paper from Mr. Tuska, of San Francisco, the subject being, "Laws relating to Horticulture." He began by calling attention to the fact that the very large attendance at the Convention from all parts of the State, proved the importance and interest of the matter. At the evening session E. J. Wickson, of San Francisco, spoke upon the advantages of local associations, quoting the older States that had both State and county Horticultural Societies; noting the advance made by California, and enumerating her counties that now had such local associations. Thursday, Nov. 16th, the report of the committee on nurserymen was read. The report thought the quarantine laws could not be enforced while there was so much opposition and quoted the strict laws of foreign countries, those of France and Germany especially, being so strict as to cause the return of a small bundle of cherry cions to California, because they were not allowed to enter there. An animated and interesting discussion followed, Mr. Haines saying that he thought the report not strong enough. He thought the public were already educated up to the point that strict quarantine laws can be now carried out. After some further discussion the report under discussion was amended so as to "new fill packages" and was adopted, as amended, by the Convention. Mr. Holt, of Riverside, recommended the holding of semi-annual Conventions in the Southern section, since by reason of the long distance, many fruit-growers of that section were cut off from the benefits of the Annual Convention. Mr. Cooke and others heartily endorsed this idea, and on being requested to put it in the form of a resolution, Mr. Holt did so, moving that the present Convention should organize such seminal Conventions, and that one should be held at Riverside in the spring, at the time of their next Citrus Fair. The motion was unanimously adopted. Mr. DeLong offered a resolution pledging the Convention to urge fruit-growers to market good fruit only, keeping the poor fruit at home, which was also adopted. In the afternoon of the 16th an exhibit was made, in a vacant lot next to the building in which the Convention was held, of the manner of spraying infested trees, after which the Convention met and were briefly addressed by J. H. Barbour from Santa Clara on varieties most in demand when put up. Dark colored fruits of all kinds colored the syrup, and were not as attractive. Strawberries were becoming scarce, the supply not meeting the demand. An erroneous impression concerning the market for canned goods prevailed. Some small shipments were made to foreign countries, but the protective tariff practically shut us out of every market of Europe, except Great Britain, where free trade prevails. For the past year California canned fruits did not exceed 600,000 cases, and 'of that amount 17,000 cases would more than cover the amount sent to foreign ports, as he believed. In London to-day there are more than 10,000 cases of apricots remaining unsold, that have been kept over from one to three years. The distance is great; in order that it shall be cheap, the canned goods must be shipped around the Horn and that means a five or six months voyage. The freight then was a great item. The fact is, that if 300 cases were sent to India it was something to be talked about; while 12,000 or 15,000 could be sent to Colorado and nothing was said. He thought the principal market was the home market, viz.: Arizona, New Mexico, Colorado, Wyoming and the parts lying along the Missouri and part of the Mississippi. Eastern goods could be put up cheap, as here sugar was twenty-five per cent higher than there, and the box plate tin was $1 and $1 50 more here than there. But they had put up alush from the first, and the only chance for competition for California could be one half the price of the box to the shipper, as thus he would be enabled to dispense with the services of two men whom he had to keep all the time to put up return boxes and besides that he thought the boxes were worth something for fuel. Then it costs from two to four bits to express back to the stnipper boxes worth six cents. After some further discussion the report under discussion was amended so as to "new fill packages" and was adopted, as amended, by the Convention. Mr. Holt, of Riverside, recommended the holding of semi-annual Conventions in the Southern section, since by reason of the long distance, many fruit-growers of that section were cut off from the benefits of the Annual Convention. Mr. Cooke and others heartily endorsed this idea, and on being requested to put it in the form of a resolution, Mr. Holt did so, moving that the present Convention should organize such seminal Conventions, and that one should be held at Riverside in the spring, at the time of their next Citrus Fair. The motion was unanimously adopted. Mr. DeLong offered a resolution pledging the Convention to urge fruit-growers to market good fruit only, keeping the poor fruit at home, which was also adopted. In the afternoon of the 16th an exhibit was made, in a vacant lot next to the building in which the Convention was held, of the manner of spraying infested trees, after which the Convention met and were briefly addressed by J. H. Barbour from Santa Clara on varieties most in demand when put up. Dark colored fruits of all kinds colored the syrup, and were not as attractive. Strawberries were becoming scarce, the supply not meeting the demand. An erroneous impression concerning the market for canned goods prevailed. Some small shipments were made to foreign countries, but the protective tariff practically shut us out of every market of Europe, except Great Britain, where free trade prevails. For the past year California canned fruits did not exceed 600,000 cases, and 'of that amount 17,000 cases would more than cover the amount sent to foreign ports, as he believed. In London to-day there are more than 10,000 cases of apricots remaining unsold, that have been kept over from one to three years. The distance is great; in order that it shall be cheap, the canned goods must be shipped around the Horn and that means a five or six months voyage. The freight then was a great item. The fact is, that if 300 cases were sent to India it was something to be talked about; while 12,000 or 15,000 could be sent to Colorado and nothing was said. He thought the principal market was the home market, viz.: Arizona,新疆，Colorado，Wyoming和the parts lying alongtheMissouriandpartoftheMississippi.Easterngoodscouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniacouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniaouldbeputupcheapasheresugarwastwentyfivepercenthighertherenandthere,theboxplate tinwas$1and$150moreherethanthere.Buththeyhadputupalushfromthefirst,andtheonlychanceforcompetitionforCaliforniaouldbeputupcheapas这里是重要的，因为我们需要对未来进行预测。我们的目标是确保未来的收益能够满足当前的需求。我们希望通过提高效率来应对未来的挑战。 The safety of the fruit-growing interest depends on the carrying out of quarantine laws. This was followed by a paper from Mr. Tuska, of San Francisco, the subject being,"Laws relating to Horticulture." He began by calling attention to the fact that very large attendance at the Convention from all parts of the State，proved its importance and interest of the matter. At the evening session E.J.Wickson，of San Francisco，spoke upon advantages of local associations，quotingthe olderStatesthathadbothStateandcountyHorticulturalSocieties；notingtheadvantagemadebyCalifornia，andenumeratinghercountiesthatnowhadsuchlocalassociations. Thursday，Nov. 16th，the report ofthecommitteeon Nurserymenwasread.Thereportthoughtthequarantinelawscouldnotbeenforcedwhilethereweresomuchoppositionandquotedthestrictlawsofforeigncountries，thoseofFranceandGermanyespecially，beingso strictastocausereturnofasmallbundleofcherryciionstoCalifornia,becausetheywerenotallowedtoenterthere.Ananimatedandinterestdiscussionfollowed，Mr.Hainessayingthathethoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough。他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.他thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that he thoughtthereportnotstrongenough.她thoughtthepublicwerealreadyeducateduptothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtthereportnotstrongenough.她thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion followed，Mr.Haines says that she thoughtshe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion follows，Mr.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion follows，Mr.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion follows，Mr.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion follows，Mr.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion follows，Mr.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion follows，Mr.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion follows，Ms.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcarriedout. After some further discussion follows，Ms.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcariedown After some further discussion follows，Ms.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcariedown After some further discussion follows，Ms.Haines says that she throughthe报ntothepointthatstrictquarantinelawscanbenowcariedown After some further discussion follows，Ms.Haines says that she throughthe报ntothe点那 After some further discussion follows，Ms.Hennesays that she throughthe报ntothe点那 After some further discussion follows，Ms.Hennesays that she throughthe报ntothe点那 After some further discussion follows，Ms.Hennesays that she throughthe报ntothe点那 After some further discussion follows，Ms.Hennesays that she throughthe报ntothe点那 After some further discussion follows，Ms.Hennesays that she throughthe报ntothe点那 After some further discussion follows，Ms.Hennesays that she throughthe报ntothe点那 After some further discussion follows，Ms.Hennesays That She ThroughtHe Report Of The Market For Nurserymen Was Ready To Sell And Discuss With The Committee On Legislation Be Instructed To Press Upon The Attention Of The Congress Of The United States; The Need Of Such A Law As Will Authorize An Effien National System Of Horticultural Quarrel Against Plants Or Regions Infested By Insects; Or Diseases Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit Or Bruit Tree; Whether Or Disease Injurious To Fruit OR Bruit Tree; Whether Or Disease Injurious To Fruit OR Bruit Tree; Whether Or Disease Injurious To Fruit OR Buitree; Whether Or Disease Injurious To Fruit OR Buitree; Whether Or Disease Injurious To Fruit OR Buitree; Whether Or Disease Injurious To Fruit OR Buitree; Whether Or Disease Injurious To Filture OR Buitree; Whether Or Disease Injurious TO Filture OR Buitree; Whether Or Disease Injurious TO Filture OR Buitree; Whether Or Disease Injurious TO Filture OR Buitree; Whether Or Disease Injurious TO Filture OR Buitree; Whether Or Disease Injurious TO Filture OR Buitree; Whether Or Disease Injurious TO Filture OR Buitree; Whether Or Disease Injurious TO Filture OR Buitree; Whether Or Disease Injurious TO Filture OR Buitree; Whether Or Disease InJurious TO Filture OR Buitree; Whether Or Disease InJurious TO Filture OR Buitree; Whether Or Disease InJurious TO Filture OR Buitree; Whether Or Disease InJurious TO Filture OR Buitree; Whether Or Disease InJurious TO Filture OR Buitree; WHETHER OR DISEASE INJURIOUS TO FILTURE OR BITTERLY IN THE MARKET FOR NURSERYMEN WAS READY TO SELL AND DISCUSSION WITH THE COMMITTEE ON LEGALITY GIVING STRESS TO THE COUNTY MANAGER WHO IS WAITING FOR THE REPORT OF THE MARKET FOR NURSERYMEN WAS READY TO SELL AND DISCUSSION WITH THE COMMITTEE ON LEGALITY GIVING STRESS TO THE COUNTY MANAGER WHO IS WAITING FOR THE REPORT OF THE MARKET FOR NURSERYMEN WAS READY TO SELL AND DISCUSSION WITH THE COMMITTEE ON LEGALITY GIVING STRESS TO THE COUNTY MANAGER WHO IS WAITING FOR THE REPORT OF THE MARKET FOR NURSERYMEN WAS READY TO SELL AND DISCUSSION WITH THE COMMITTEE ON LEGALITY GIVING STRESS TO THE COUNTY MANAGER WHO IS WAITING FOR THE REPORT OF THE MARKET FOR NURSERYMEN WAS READY TO SELL AND DISCUSSION WITH THE COMMITTEE ON LEGALITY GIVING STRESS TO THE COUNTY MANAGER WHO IS WAITING FOR THE REPORT OF THE MARKET FOR NURSERYMEN WAS READY TO SELL AND DISCUSSION WITH THE COMMITTEE ON LEGALITY GIVING STRESS TO THE COUNTY MANAGER WHO IS WAITING FOR THE REPORT OF THE committee on nurserymen was read. The report thought the quarantine laws could not be enforced while there was so much opposition and quoted the strict laws of foreign countries, those of France and Germany especially, being so strict as to cause the return of a small bundle of cherry cions to California, because they were not allowed to enter there. An animated and interesting discussion followed, Mr. Haines saying that he thought the report not strong enough. He thought the public were already educated up to the point that strict quarantine laws can be now carried out. Mr. A. D. Pryal, of Alameda, said that halt a million trees had just arrived in Oakland; they were shipped from the East, and were fully infested. They had all been sent North and fruit from the north was shipped here. If a quarantine law, extending over the whole year,"instead of through a few months of the year, had been in existence, he could have arrested those infested trees and he would have done it, and he would have burned them, every one, if he had to call in his neighbors to help do it. The report was not adopted. The next report was from the fruit-growers committee. It recommended the appointment of a State Entomologist, whose duty should be to study California insect pests, to report on the same, and to give instruction at the State University. The report further recommended the drying of good fruit, of that quality that would command the market of the world, and that the State Horticultural Association be made a permanent institution. Mr. Britton said that he was a fruit-grower and a box manufacturer. Boxes sent to the canneries with the express condition that, when the fruit was out of them, they should be burned, were piled up in the yard of the cannery and sold to every one who wanted to buy a cheap box for any purpose. A man would come to his box factory and ask the price of boxes, and, on being told they were six cents, would say that there was no use in buying them at that price as he could get thousands of them at the canneries for three cents. Another member of the Convention thought the free box system is what they would all come to eventually. Their interest was in stopping the insect pest, and if free boxes were used to the canneries they need not be piled up there, it could be seen that they were destroyed, and believed that good fruit was worthy a clean box. Mr. Pithia believed in disinfected boxes, then was a great item. The fact is, that if 300 cases were sent to India it was something to be talked about; while 12,000 or 15,000 could be sent to Colorado and nothing was said. He thought the principal market was the home market, viz: Arizona, New Mexico, Colorado, Wyoming and the parts lying along the Missouri and part of the Mississippi. Eastern goods could be put up cheap, as here sugar was twenty-five per cent. higher than there, and the box plate tin was $1 and $1.50 more here than there. But they had put up slush from the first, and the only chance for competition for California was that her canneries had put up the best goods in the best manner. He then urged upon growers the necessity of supplying good fruit only, saying that of that brought to his cannery only about one-third could be profitably used. A higher grade of fruit was necessary to extend the market. If the cost of canned fruits could be decreased the market would be increased. The demand for California canned fruit, at present prices, is fully met, but the markets could readily be extended by reducing the price; the price of green fruit must be materially lessened. A discussion on what would be considered fair prices then followed, and also of the causes of the present high price of sugar, which closed by the assertion that the machinery and methods in California, for putting up fruit, was second to none in any other part of the world. E. Hayden, a commission merchant of San Francisco, next read a paper, its subject being "Dried Fruit Interests." It is an industry that stands foremost with the export products, having grown with the country. Care should be taken to see that the fruit is ripe, but not too ripe. Decayed fruit will not dry; neither will green, hard, scaly or wormy fruit make good dried fruit. This fruit that is dried is not used at home, it is sent away, in some instances thousands of miles, and must be of a quality to pay the costs of transportation, which added to the first cost, makes it a luxury, and as a luxury it must be good or it will not be remunerative. The amount received for dried fruit is fully equally to that paid by the associated canneries—one pound of dried fruit representing five pounds of green, one carload of dried equalizing six carloads of green fruit. The sale of dried fruit to-day amounts to $2,000,000, a result not surprising when it is considered that the main crop this year will amount to nearly 200,000 boxes, and at an average price of $2,124 will be $600,000, or one-fourth the amount stated. If this is worthy encouragement we saw that such a quality of fruit shall be produced as will make the present demand ten-fold. In the meantime there is an exhibition dried fruit which is not only a credit to the producers but in the State. His mother tae: "Put up nothing to sell that is not first-class and what is put up in shops to meet the requirements for quarantine laws could not be enforced while there was so much opposition and quoted the strict laws of foreign countries, those of France and Germany especially, being so strict as to cause the return of a small bundle of cherry cions to California, because they were not allowed to enter there. An animated and interesting discussion followed, Mr. Haines saying that he thought the report not strong enough. He thought the public were already educated up to the point that strict quarantine laws can be now carried out. Mr. A. D. Pryal, of Alameda, said that halt a million trees had just arrived in Oakland; they were shipped from the East, and were fully infested. They had all been sent North and fruit from the north was shipped here. If a quarantine law, extending over the whole year,"instead of through a few months of the year, had been in existence, he could have arrested those infested trees and he would have done it, and he would have burned them, every one, if he had to call in his neighbors to help do it. The report was not adopted. The next report was from the fruit-growers committee. It recommended the appointment of a State Entomologist, whose duty should be to study California insect pests, to report on the same, and to give instruction at the State University. The report farther recommended the drying of good fruit, of that quality that would command the market of the world, and that the State Horticultural Association be made a permanent institution. Mr. Britton said that he was a frugtgrower and a box manufacturer. Boxes sent to the canneries with the express condition that, when the fruit was out of them, they should be burned, were piled up in the yard of the cannery and sold to every one who wanted to buy a cheap box for any purpose. A man would come to his box factory and ask the price of boxes, and, on being told they were six cents, would say that there was no use in buying them at that price as he could get thousands of them at the canneries for three cents. Another member of the Convention thought the free box system is what they would all come to eventually. Their interest was in stopping the insect pest, and if free boxes were used to the canneries they need not be piled up there; it could be seen that they were destroyed,and believed that good fruit was worthy a clean box. Mr. Pithia believed in disinfected boxes, then was a great item. The fact is, that if 300 cases were sent to India it was something to be talked about; while 12,000 or 15,000 could be sent to Colorado and nothing was said. He thought the principal market was the home market,viz: Arizona,新 Mexico，Colorado，Wyoming和the parts lying alongthe Missouriand partoftheMississippi.Easterngoodscouldbeputupcheap，ashereugarwastwenty-fivepercentpercent。higherthanthere,andthe板plate tinwas$1and$150moreherethanthere。但theyhadputupslushfromthefirst,andtheonlychanceforcompetitionforCaliforniawasthathercannerieshadputupthebestgoodsinthebestmanner。他thenurgedupgrowersthenecessityofsupplyinggoodfruitonly,sayingthatofthatbroughttohiscanneryonlyaboutonethirdcouldbeprofitablyused.AhighergradeoffruitwassnecessarytoextendthemarketIfthecostofcannedfruitscouldbedecreasedthemarketwouldbeincreased.ThedemandforCaliforniacannedfruit.atpresentpricesisfullymetbutthemarkebcouldreadilybeextendedbyreducingtheprice;thepriceofgreenfruitmustbecateriallylessened.Adiscussiononwhatwouldbeconsideredfairpricesthenfollowed,andalsoofthecausesofthepresenthighpriceofsugarwhichclosedbytheassertionthatthemachineryandmethodsinCalifornia.forputtingupfruit.wassecondtononeinanyotherpartoftheworld. E.Hayden,acommissionmerchantofSanFrancisco,nextreadapaper,其subjectbeing"DriedFruitInteresta."Itisanindustrythatstandforemostwiththeexportproducts,havinggrownwiththecountry.Careshouldbeknowntoseethatthefruitisripe,但nottoripe.Decayedfruitwillnotdry;neitherwillgreen,hard,scalyorwormyfruitmakegooddriedfruitThisfruitthatisdriedisnotusedathome,它issentaway,在someinstancesthousandsofmiles,andmustbeofaqualitytopaythecostsoftransportationWhichaddedtocothefirstcost,makesitlauxury,andaslauxuryitmustbegoodoritwillnotbereminative.Theamountreceivedfordriedfruitisfullyequaltothatpaidbytheassociatedcanneries-onepoundofdriedfruitrepresentingfivepoundsofgreen,一carloadofdriedequalingsixcarloadsofgreenfruit.Thesaleofdriedfruitto-dayamountsto$2,000,000,aresultnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200,000boxes,andataneveragepriceof$2,$124willbethes$600,$000,或one-fourththeamountstated.Flthisisworthyencouragementwe sawthatsuchaqualityoffruitshallbeproducedaswillmakethepresentdemandten-fold.InthemeantseasonthereismathenailsdirecttotheproducerlistintheState.Hismothertae:"Putupnothingtosellthatisnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200,000boxes,andataneveragepriceof$2,$124willbethes$600,$000,或one-fourththeamountstated.Flthisisworthyencouragementwe sawthatsuchaqualityoffruitshallbeproducedaswillmakethepresentdemandten-fold.InthemeantseasonthereismathenailsdirecttotheproducerlistintheState.Hismothertae:"Putupnothingtosellthatisnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200,000boxes,andataneveragepriceof$2,$124willbethes$600,$000,或one-fourththeamountstated.Flthisisworthyencouragementwe sawthatsuchaqualityoffruitshallbeproducedaswillmakethepresentdemandten-fold.InthemeantseasonthereismathenailsdirecttotheproducerlistintheState.Hismothertae:"Putupnothingtosellthatisnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200,000boxes,andataneveragepriceof$2,$124willbethes$600,$000,或one-fourththeamountstated.Flthisisworthyencouragementwe sawthatsuchaqualityoffruitshallbeproducedaswillmakethepresentdemandten-fold.InthemeantseasonthereismathenailsdirecttotheproducerlistintheState.His母亲tae:"Putupnothingtosellthatisnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200,000boxes,andataneveragepriceof$2,$124willbethes$600,$000,或one-fourththeamountstated.Flthisisworthyencouragementwe sawthatsuchaqualityoffruitshallbeproducedaswillmakethepresentdemandten-fold.InthemeantseasonthereismathenailsdirecttotheproducerlistintheState.His母亲tae:"Putupnothingtosellthatisnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200,000boxes,andataneveragepriceof$2,$124willbethes$600,$000,或one-fourththeamountstated.Flthisisworthyencouragementwe sawthatsuchaqualityoffruitshallbeproducedaswillmakethepresentdemandten-fold.InthemeantseasonthereismathenailsdirecttotheproducerlistintheState.His母亲tae:"Putupnothingtosellthatisnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200,000boxes,andataneveragepriceof$2,$124willbethes$600,$000,或one-fourththeamountstated.Flthisisworthyencouragementwe sawthatsuchaqualityoffruitshallbeproducedaswillmakethepresentdemandten-fold.InthemeantseasonthereismathenailsdirecttotheproducerlistintheState.His母亲tae:"Putupnothingtosellthatisnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200,000boxes,andataneveragepriceof$2,$124willbethes$600,$000,或one-fourththeamountstated.Flthisisworthyencouragementwe sawthatsuchaqualityoffruitshallbeproducedaswillmakethepresentdemandten-fold.InthemeantseasonthereismathenailsdirecttotheproducerlistintheState.His母亲tae:"Putupnothingtosellthatisnotsurprisingwhenitisconsideredthatrastaincreepthisyearwillamounttonearly200, GAZETTE. EMBER 2, 1882. NO. 8 First, boxes of regular weight, well packed, or surfaced. Second, each itself, no mixing two or more dried should have the ap-riose fruit. This can be done in tap manner, resulting in an ideal for the product. Fruit dried should be placed on as peeled or stoned, then box, say from twelve to eight, twelve inches if only but it needs to be higher if used, and a teaspoonful of replaced under the tray and there four or five minutes should be put into a pan con-duit. This is all that is needed the fruit is taken out and served on boards if it is to be instructed: Give us good pay you good clean money will find that the amount of fruit can not be overdone, than you will be able to dry been more truthfully shown than in the improved exhibit at the late County Fair,) a box of deticiously fair fruit being shown from what was at one time one of the worst of the infected orchards. At another side of the room (the exhibit filled the hall) some of the lye and soda solutions were ranged on tables, in large glass jars, labeled, etching strength of solution. The lye solutions generally of 1lb to 1 gallon of water. One of caustic soda and potash was 9 per cent. of soda and 10 per cent. of potash to the gallon of water. Here too was a large cluster of flowers of the Pyrethrum aneraber, from which the Persian Insect Powder is made; it is also called "Buhach." The flowers are over an inch across, white, single, having a yellow center and are very pretty. MRS. TUTAINE — TRAIN-WRECKER. Los Angeles Herald, Nov. 23. Yesterday at 2 o'clock United States Commissioner Lee commenced the examination of Mrs. Lucy Tutaine and her son John, who are charged with interrupting and interfering with the United States mail. The real head and front of their offending consisted in an attempt to wreck a passenger train near San Gorgonio Pass, two weeks ago, at which time a most terrible disaster was averted by almost a miracle. The manner and cause of the arrest, as well as a detailed account of the mishap, have been duly chronicled in the Herald. The examination of John Tutaine, the 16-year old son of Lucy Tutaine, was first taken up, during which the lad conferred to the perpetration Diphtheria. The latest and most successful treatment for this dreaded disease has largely come to our knowledge, and having interviewed the man who says his life was saved by the new treatment we feel confident it is our duty to give the facts to our readers, that they may investigate for themselves. The circumstances are as follows: Amade Charlier, of West Farnham, P. Q., recently had diphtheria; he became so bad off after a relapse that all hopes of his recovery was abandoned by his physicians and friends, and as a last resort a brother of the patient said that he had a bottle of Kendall's Spavin Cure and wished to try it. He applied it to the neck, and then reduced a little, and the patient after some difficulty succeeded inurgling it in the throat. He soon noticed some improvement, and by continuing its use a complete cure was effected, and now he says he knows it moved his life. The above remarkable experience led us to investigate farther, and we found that Kendall's Spavin Cure has the most remarkable effect on human flesh of any remedy of which we have ever heard, and we have become soundly converted to the opinion that no remedy has ever been discovered which possesses such remarkable qualities for the diseases of man as well as beast. Every one should cut this out and paste into a scrap-book.—Times. SPRINGFIELD, Me., Nov. 25.—In a trial against the town for the death of a young lady by a defective highway, one doctor tried that her collar bone was broken, while two others contradicted the first. To head off a post mortem he went to the courtary to exhume the body and make good his testimony by breaking her collar bone. He was Third, the action of the court closes the pores, stopps and thereby adding to its extraveled thousands of miles Washington Territory, giving it to dry their apple crops. Qualities are raised in Oregon for green fruit. California is demand existing to-day, and fruit can not be overdone than you will be able to dry one. Let the canning and brets go, and don't stop or run the way of the progress institutions; they are builded your children something omanians, should be proud of, her fruit producing State of What kinds do the marsh kinds. The most profit for future consideration. At all we can get and ten times. Prices for properly constantly improving. Four California raisins were sell-incoisco for $1 per box, now 2.12½ to $2.37¾." Then stated for the commers, that raisins and prunes imported into this country,gressman-elect had assured us would be left untried to give tariff on these goods, so necessary to reduce the price of those two, at which might be expected to go the Chief Executive Officer and a vote of thanks offeration was offered by Proto the effect that the commission be instructed to pression of the Congress of the need of such a law as efficient national system ofarantine against places or by insects, or diseases injurious fruit trees, whether such be within the jurisdiction states or without its borders. Was was one offered by Mr. being the amendment of the Horticultural Commissioner constitutional, by the next that the law may be effective. And interesting feature of the exhibition, in the small theater building, of insect pests their growth; the appearance of plants and fruits, and the so far as they are known tried. A partial list will contain kind of plants and trees knocked: Apple with woolly rose duil looking; peach with macrosus—tree partially dew with same, not treated—tree with same, not treated—each prunes with same, not killed; plum with same, not killed; Lawton raspberry with bush killed; rosebush with white scale; rosebush with Diaspis—main part of bush with Aspidiotus and Diaspis almond tree with Aspidiotus red spider looking to the small red lichen covering Winter Nellis pear, with musus in all stages of growth—shriveled, one-sided, bark the effect on the wood which decay; and from Oak Hill missionist fire committed the examination of Mrs. Lucy Tutaine and her son John, who are charged with interrupting and interfering with the United States mail. The real head and front of their offending consisted in an attempt to wreck a passenger train near San Gorgonio Pass, two weeks ago, at which time a most terrible disaster was averted by almost a miracle. The manner and cause of the arrest, as well as a detailed account of the mishap, have been duly chronicled in the Herald. The examination of John Tutaine, the 16-year old son of Lucy Tutaine, was first taken up, during which the lad confessed to the perpetration of the crime at the instigation of his mother. At 5 o'clock, the examination not being completed, it was continued till this morning at half-past 9 o'clock. The scene presented on a cursory glance into the Commissioner's office at the time the examination was going on was an extremely interesting one. The Commissioner was seated at his desk interrogating the boy criminal, who was in front of him. Seated around the room were Deputy United States Marshal Dunlap, Mr. Len Harris, the detective of the railroad company, Constable R. A. Ling, all of whom took an active part in the arrest of the train-wreckers. Near by was Mr. A. Glassell, the attorney of the railroad, and opposite sat the now notorious Mrs. Tutaine near her counsel, Mr. G. M. Holton. The boy and the mother furnished a study to the observer. The woman seemed to be trying to petrify the tongue of her son, who was swearing away his own and her liberty. The boy persistently shut out the sight of his mother's beneful eyes by holding his hand against his face, so that he might not, by a mishap, catch a sight of her vindictive glances. But the central figure of the group was the woman herself. If ever human creature was really cursed with the "evil eye," thus woman is. A round face, from which two basilisk eyes of blue flashed out their venomous looks, surmounted a leau, gaunt body, poorly covered by a miserable dress of cheapest material. Over her shoulders was thrown a shawl which had no doubt seen better days in a dim and perhaps forgotten past. An old straw bonnet made up her costume. But of it all, the face was one to which one's notice was horribly attracted. The mouth of a beast of prey hid a strong set of teeth; a strong, masculine chin marked a strength of will and of purpose that enabled one at a glance to understand the reputation for masculine daring which the woman bears in the community. A strong, nervous excitement convulsed her as the trial progressed, and as her son would describe different stages of their crime, she would rise from her seat with a feervish movement as though she would leap upon her own offspring and tear him limb from limb, but the vigilant eyes of the officers present apparently restrained her and she would fall back into her chair with a fiendish glare in her eyes as though Medusa-like, she would turn to stone whomever she would look upon. To-day, no converted to the opinion that no remedy has ever been discovered which possesses such remarkable qualities for the diseases of man as well as beast. Every one should cut this out and paste into a scrap-book. SPRINGFIELD, Me., Nov. 25.-In a trial against the town for the death of a young lady by a defective highway, one doctor testified that her collar bone was broken, while two others contradicted the first. To head off a post mortem he went to the courthery to exhume the body and make good his testimony by breaking her collar bone. He was discovered in the act of digging up the corpse by a person who was at first bribed, but who has since told the whole story. A Chance for Fun. The "latest thing out" in the way of something to afford home amusement for winter evenings, or a side-show for church fairs, consists of a sort of Magic Lantern that doesn't require pictures on glass. The Polyopticon, as it is called because it will show up so many different things, makes use of ordinary newspaper pictures, family photographs, chroma cards, home-made sketches etc., and thus affords a new use for the collections of pretty cards which so many have been industriously making. Though patented, it can be made and sold at one fourth the price of a good Magic Lantern. Descriptive circulars can be obtained of the Murray Hill Publishing Co., 129 Eats Twenty-eighth St., N.Y. City. WASHINGTON, Nov. 24.-A special census bulletin shows that in the United States there are 4,923,451 persons of ten years of age and upwards unable to read and 6,239,958 unable to write. Of the number of persons returned as unable to write 3,019,060 are white. The native whites unable to write number 225,460. The colored persons of ten years of age and upwards unable to write are 3,220,878, or seventy per cent. of the population. Illiteracy is confined principally to the Southern States. "Magnificent promises sometimes end in paltry performances." A magnificent exception to this is found in Kidney-Wort which invariably performs even more cums than it promises. Here is a single instance: "Mother has recovered," wrote an Illinois girl to her Eastern relatives." "She took batters for a long time but without any good. So when she heard of the virtues of Kidney-Wort she got a box and it has completely cured her liver complaint." Two orders from the United States Land Office at Washington have been received by Surveyor General Brown. They refer to the reservation of lands for the Mission Indians in the State, and the direct restoration to the public domain of land now occupied by the Mission Indians, comprising about 800 acres located in San Diego county. Old Mother Shipton. Considerable "stock" was taken in what Mother Shipton said would come to pass in year 1881 by those who are ready to swallow down every whim that floats along; but these same persons will suffer from hav- Free Distribution of Seeds. Edwin F. Smith, Secretary of the State agricultural society, has for distribution the following seeds: Acme tomato, collards, creole stock; radish, French breakfast; parsnips, long, smooth, okra, prolific; turnip, white strip leaf and mountain sweet; squash, summer golden crook neck; onion, yellow globe; watermelon, mountain sweet, carrot, long orange; muskmelon, green citron; kale, dwarf German and tall curled Scotch; cabbage, premium flat Dutch; lettuce, early curled Simpson; cucumber, long green; spinach, savory leaved; mangel wurzel, nobitam giant; sugar corn, asylum; peas, Daniel O'Rouke; beans, early, long, yellow; wheat and tobacco. Those receiving seeds are expected to report the result of the trials made, together with the method of culture, and any other information that may be of interest to others. It is also expected that the recipients will preserve a portion of seed for distribution among their neighbors should the seeds prove of value. Address the Secretary at Sacramento. Stockton, November 25—Peter Crane to-day attempted to kill himself by cutting his throat. He was found by his daughter Annie, a young lady 20 years of age, in a chicken-house, lying in a pool of blood with a razor, a whatstone and a looking glass beside him. His wife picked him up and carried him in her arms to the house, with the blood pouring from the terrible wound in his throat. Both jugular veins, the windpipe and conjugae were around. There is no hope of his recovery. He has been designed for eight months, and he imagined he was paralyzed by illness. He was 60 years of age. Two orders from the United States Office at Washington have been received by Surveyor General Brown. They refer to the reservation of lands for the Mission Indians in the State, and the direct restoration to the public domain of land now occupied by the Mission Indians, comprising about 800 acres located in San Diego county. Old Mother Shipton. Considerable "stock" was taken in what Mother Shipton said would come to pass in the year 1881 by those who are ready to swallow down every whim that floats along; but these same persons will suffer from having all sorts of humors for years, before they will believe that fifty cents' worth of Swayne's Ointment will effectually cure them. Ministers, judges, lawyers, and even physicians have testified to its merita. Try it. Singular—we don't suppose there is any design in it—but it's a singular fact that the medical colleges always holds their commencements just before green apples are big enough to wrestle and kick. Among the books of Popular Medical Literature which have become widely known and appreciated by the general public, none maintains a steadier sale or more favored place in the opinion of the press and the people, than "PLAIN HOME TALK" and "MEDICAL COMMON SENSE," by Dr. R. B. Poote of 120 Lexington Ave., N. Y. City. In bringing out their complete illustrated edition of nearly 1,000 pages, bound in cloth, at the remarkably low price of $1.50, the publishers have insured for themselves prosperity in "large sales at small profits," and for the public the boon of good and instructive reading at a prize within the reach of all book-buyers. The contents table can be had free of the Murray Hill Publishing Co., 129 East Twenty-eighth St., N. Y. City. Gunn is a most unhappy name. Appious inquirers are always wanting to know if you are a son of a Gunn. Subscribers to Dr. Foote's Health Monthly are offered unusually liberal prescriptions for the coming year. There is a long list of Scientific Works, two of which are sent with THE HEALTH MONTHLY one year for fifty cents, and in the list of $1 premiums are included an elegant edition of Shakespeare and the Amateur Standard Dictionary, books that have retained largely at $3 new copy. The illustrated premium list and a sample copy of the paper are forward A fine by the publishers, the Murray Hill Publishing Co., 129 East Twenty-eighth St., New York City.